Previous Article | Next Article ![]()
Applied and Environmental Microbiology, December 1998, p. 4757-4766, Vol. 64, No. 12
Departments of Biological
Sciences,1
Agricultural,
Received 20 March 1998/Accepted 18 September 1998
Brochocin-C, produced by Brochothrix campestris ATCC
43754, is active against many strains of the closely related meat
spoilage organism Brochothrix thermosphacta and a wide
range of other gram-positive bacteria, including spores of
Clostridium botulinum. Purification of the active compound
and genetic characterization of brochocin-C revealed that it is a
chromosomally encoded, two-peptide nonlantibiotic bacteriocin. Both
peptides of brochocin-C are ribosomally synthesized as prepeptides that
are typical of class II bacteriocins. They are cleaved following
Gly-Gly cleavage sites to yield the mature peptides, BrcA and BrcB,
containing 59 and 43 amino acids, respectively. Fusion of the
nucleotides encoding the signal peptide of the bacteriocin divergicin A
in front of the structural genes for either BrcA or BrcB allowed
independent expression of each component by the general protein
secretion pathway. This revealed the two-component nature of
brochocin-C and the necessity for both peptides for activity. A
53-amino-acid peptide encoded downstream of brcB functions as the immunity protein (BrcI) for brochocin-C. In addition, the cloned
chromosomal fragment revealed open reading frames downstream of
brcI, designated brcT and brcD,
that encode proteins with homology to ATP-binding cassette translocator
and accessory proteins, respectively, involved in the secretion of
Gly-Gly-type bacteriocins.
Bacteriocins are antimicrobial
peptides or proteins, produced by bacteria, that generally have a
narrow spectrum of antibacterial activity against closely related
species. In recent years, bacteriocins of lactic acid bacteria have
been studied as possible biological preservatives in foods.
Bacteriocins were classified by Klaenhammer (18) into four
groups. Class I bacteriocins, known as lantibiotics, are ribosomally
produced, but they undergo extensive posttranslational modification to
produce the active peptide. Nisin is a well-characterized lantibiotic
produced by Lactococcus lactis subsp. lactis.
This class I bacteriocin has a broad spectrum of activity that includes activity against many gram-positive bacteria and also inhibits the
outgrowth of bacterial spores. It has been widely applied as a food
preservative, but it has limited potential for biopreservation of meat
because it is poorly soluble above pH 5.0 and it interacts with
phospholipids (8, 17). Most of the well-characterized bacteriocins produced by lactic acid bacteria are nonlantibiotic, heat-stable, low-molecular-weight class II bacteriocins
(18). They are produced as prepeptides, and
posttranslational modification is generally limited to cleavage of the
N-terminal leader peptide following a Gly-Gly site. Class II
bacteriocins can be subdivided into (i) peptides that contain a
Tyr-Gly-Asn-Gly-Val-Xaa-Cys motif near their N termini and (ii)
two-peptide bacteriocins. Most class II bacteriocins have a limited
spectrum of antibacterial activity that restricts their usefulness for
control of bacterial spoilage of meat and pathogenic microorganisms in meat.
Our laboratory has targeted the development of gene cassettes capable
of producing multiple bacteriocins which, in combination, could have an
antibacterial spectrum equivalent to or better than that of nisin and
which are also suitable in preservation of fresh meat. As part of this
strategy, we screened for bacteriocins from Brochothrix spp.
that are active against Brochothrix thermosphacta (unpublished data). This gram-positive, facultative anaerobe is an
important spoilage organism of meats stored at chill temperatures, because it can impart an off odor in vacuum- or
modified-atmosphere-packaged meats (10). Problems arise when
conditions of meat storage allow growth of B. thermosphacta,
for example, with high pH (6.0 to 6.5) meat and/or at low
concentrations of oxygen (5, 11, 12). B. thermosphacta was the only species in the genus
Brochothrix, but through taxonomic and DNA hybridization
studies of a number of strains isolated from a variety of sources,
Talon et al. (34) in 1988 described a second species,
Brochothrix campestris. Apart from its initial discovery and
characterization, limited information on this organism is available. To
date it has been isolated only from soil and grass; however, it is
possible that in the past it was misidentified as B. thermosphacta.
Brochocin-C, a bacteriocin produced by B. campestris ATCC
43754, was originally discovered and classified as a bacteriocin by
Siragusa and Nettles Cutter (30). It was reported to be
active against 35 strains of B. thermosphacta, 10 strains of
Listeria monocytogenes, and several strains of
Carnobacterium, Enterococcus, Kurthia,
Lactobacillus, and Pediococcus but not against
gram-negative bacteria. Hence, brochocin-C is a good candidate for
inclusion in an arsenal of bacteriocins that might be suitable for
biopreservation of meats. In this study, we determined the biochemical
and genetic characteristics of brochocin-C. Purification of the
antimicrobial compound and determination of its amino acid sequence was
used as the basis for cloning and DNA sequencing of the chromosomal bacteriocin genes. Heterologous expression of the structural and immunity genes of brochocin-C confirmed the role of these genes in the
production of this potent bacteriocin.
Bacterial strains and plasmids.
The bacterial strains and
plasmids used in this study are listed in Table
1, except for the target bacteria used to
determine the antibacterial spectrum of brochocin-C. All strains were
stored at Purification of brochocin-C.
Five liters of sterile CAA
medium (14) with 2.5% glucose was inoculated with 2% of an
overnight culture of B. campestris ATCC 43754 and grown at a
constant pH of 6.7 with a Chemcadet controller (Cole-Parmer, Chicago,
Ill.) for addition of filter-sterilized 2 N NaOH. Cells were removed by
centrifugation at 8,500 × g for 20 min. The
supernatant was extracted twice with 1.5 liters of n-butanol. The butanol fraction was diluted with water (1:1)
and concentrated by vacuum evaporation at 35°C to remove all traces of butanol. The bacteriocin extract was precipitated with 1.7 liters of
cold ( Bacteriocin assays and antibacterial spectrum of
brochocin-C.
Determination of arbitrary activity units (AU) of
bacteriocin per milliliter was based on the reciprocal of the greatest
dilution of the concentrated bacteriocin solution that showed activity against Carnobacterium divergens LV13 (4).
Inhibition of C. piscicola LV17C was examined by the
addition of 100 AU of partially purified brochocin-C per ml to APT
broth (pH 6.5) and to phosphate buffer (50 mM, pH 6.5) containing
106 CFU of the indicator organism per ml, to determine the
bactericidal or bacteriostatic action of the bacteriocin. Viable counts
were determined on APT agar at selected time intervals, and cell lysis was checked by monitoring the optical density at 600 nm. Antagonistic activity against a wide range of bacterial strains was determined by
deferred-inhibition or spot-on-lawn assays (2) with
partially purified brochocin-C at 100 and 800 AU of brochocin-C per ml
determined against C. divergens LV13. For spot-on-lawn
activity assays, strains of Carnobacterium,
Enterococcus, Lactococcus,
Leuconostoc, and Brochothrix were grown in APT
broth; Lactobacillus and Pediococcus strains were
grown in Lactobacilli MRS broth (Difco); Bacillus, Staphylococcus, and Streptococcus strains were
grown in tryptic soy broth (Difco); and Listeria strains
were grown in tryptic soy broth with 0.6% yeast extract. Strains of
Clostridium botulinum and other Clostridium spp.
were grown in Trypticase-peptone-glucose-yeast extract broth (TPGYE)
(5% Trypticase, 0.5% peptone, 0.4% glucose, 2% yeast extract, pH
7.2) with 1% sodium thioglycolate added prior to use in bioassays.
Spores of Bacillus spp. were prepared by growing the strains
aerobically in GBBM (41), and spores of Clostridium spp. other than C. botulinum were
prepared under anaerobic growth conditions in sporulation medium (SM)
(5% Trypticase, 1% peptone, pH 7.2) (16). Inocula for
C. botulinum were grown at 30°C for 24 h in
Trypticase-peptone-glucose-yeast extract broth with 1% sodium
thioglycolate added and were grown for spore production in SM with 1%
sodium thioglycolate. For nonproteolytic strains, SM was supplemented
with 0.2% glucose and 0.3% K2HPO4.
Sporulation was monitored by phase-contrast microscopy. After 4 to 8 days, C. botulinum spores were harvested and washed 10 times
by repeated centrifugation (16,300 × g for 10 min at
4°C) and resuspension in cold 0.85% NaCl. Spore crops were
maintained at 4°C in 0.85% NaCl. Except for C. botulinum,
germination of spores for inhibition studies was stimulated by heat
shocking the spores of Bacillus and Clostridium
spp. at 80°C for 30 min and 75°C for 15 min, respectively. Nonproteolytic strains of C. botulinum were heat shocked at
55°C for 15 min, and proteolytic strains were heat shocked at 80°C for 10 min. The concentration of spores inoculated into soft APT agar
depended on the amount needed to produce a confluent lawn. The activity
of brochocin-C against a wide range of gram-negative bacteria, and
against E. coli ATCC 25922 and Salmonella
choleraesuis ATCC 10708 in the presence of 20 mM EDTA, was also
tested (32). Nisin (Aplin and Barrett, Ltd., Langford,
United Kingdom) was used as a control according to the study of Stevens
et al. (32). The stock solution of nisin (10 mg
ml Activity and stability of brochocin-C.
B. campestris
was grown in APT broth at 25°C for 18 to 24 h, cells were
separated by centrifugation (8,500 × g for 15 min), and the supernatant was heated at 65°C for 30 min, cooled, and adjusted to pH 2 through 9 with either 5 N HCl or 5 N NaOH. The heat
stability of the pH-adjusted supernatant was determined at 65°C for
30 min, 100°C for 15 min, or 121°C for 15 min by testing for
residual activity by the spot-on-lawn assay against C. piscicola LV17C. The effect of proteolytic enzymes and organic
solvents was determined with preparations of butanol-extracted
brochocin-C. For stability in organic solvents, the bacteriocin
preparation was diluted in 0.1% TFA, 95% ethanol, 100% methanol, or
100% acetonitrile to give an initial concentration of 10 AU
µl Determination of the amino acid sequence of brochocin-C.
The
N-terminal amino acid sequence of purified brochocin-C was determined
by the Alberta Peptide Institute (University of Alberta, Edmonton,
Alberta, Canada) by automated Edman degradation with a gas-phase
sequencer (Applied Biosystems model 470A) with on-line
phenylthiohydantoin-derivative identification by high-pressure liquid
chromatography (Applied Biosystems model 120A chromatograph). The mass
spectrum of purified brochocin-C was measured by electrospray ionization (Fisons Trio 2000 mass spectrometer; done by L. Hogg at the
Plant Biotechnology Institute, National Research Council of Canada,
Saskatoon, Canada). The sample was dissolved in acetonitrile-water (1:1) containing 1% formic acid and was loop injected (10 ml) at a
flow rate of 6 ml min DNA isolation, manipulation, and hybridization.
Isolation of
plasmids from B. campestris, E. coli, and
carnobacteria was done as previously described (2, 29, 40). Preparation of chromosomal DNA from B. campestris grown (2%
inoculum) in 40 ml of APT broth to an optical density at 600 nm of 0.6 was done as described by Quadri et al. (28). Standard
methods were used for restriction enzyme digestion, ligations, gel
electrophoresis, and E. coli transformation (29).
Transformation of carnobacteria was done as described by Worobo et al.
(40). T4 DNA ligase and restriction endonucleases were
obtained from Boehringer-Mannheim (Dorval, Québec, Canada),
Promega (Burlington, Ontario, Canada), and New England Biolabs
(Mississauga, Ontario, Canada). Colony blots were done by standard
methods (31), and DNA fragments were blotted by the method
of Southern (31) onto Hybond N (Amersham Corp.) nylon
membranes. A degenerate 23-mer oligonucleotide probe [APO-1,
5'-AAAGATATTGG(ATC)AAAGG(ATC)ATTGG-3'] based on
residues 8 to 15 of the amino acid sequence of the active compound was used to locate the brochocin-C structural gene in both colony blot and
Southern hybridizations. Oligonucleotides based upon derived nucleotide
sequences were synthesized (Applied Biosystems 391 PCR Mate
synthesizer), quantified, and used for hybridizations or as primers for
nucleotide sequencing. DNA probes were radioactively end labeled with
[ Cloning of the brochocin gene.
Genomic DNA from B. campestris ATCC 43754 was digested with EcoRI. DNA
fragments of 4.4 kb corresponding to the hybridization signal
identified with APO-1 were isolated and purified from the gel. The
resulting fragments were cloned into the EcoRI site of pUC118. E. coli DH5 Nucleotide sequencing of plasmid DNA.
The nucleotide
sequence was determined by Taq DyeDeoxy Cycle sequencing
(Department of Biochemistry or Department of Biological Sciences,
University of Alberta) on an Applied Biosystems model 373A sequencer by
using the universal forward and reverse primers of pUC118.
Site-specific 18-mer primers based on newly sequenced DNA were
synthesized for further sequencing. Protein and nucleotide sequence
analyses were performed with the DNASTAR software program (DNASTAR,
Inc., Madison, Wis.). Homology searching of proteins was based on the
FASTA algorithm of Pearson and Lipman (26).
Construction of expression clones of brochocin-C.
To
investigate the roles of the open reading frames (ORFs) designated
brcA, brcB, and brcI (Fig.
1), several expression
clones were constructed in E. coli and transformed into
strains of carnobacteria. The expression clones were designed to create
in-frame translational fusions of brcA and/or
brcB with the nucleotide sequence encoding the divergicin A
signal peptide (40). The nucleotide sequence of this signal
peptide contains a HindIII restriction endonuclease site
which cuts 10 nucleotides upstream of DNA encoding the signal peptide
cleavage site (40). Two primers, JMc10
(5'-CCCAAGCTTCTGCTTACAGTTCAAAAGATTGTCTA-3') and
JMc29 (5'-GCGAAGCTTCTGCTAAAATAAATTGGGGAAATG-3'),
were designed to facilitate this fusion. The first 14 nucleotides
of each primer regenerated the HindIII site (underlined)
of the signal peptide as well as the additional amino acids
(Ala-Ser-Ala) of the cleavage site. The remaining nucleotides of each
primer are complementary to the 5' ends of the nucleotide sequences
encoding the mature portions of the brcA and brcB
gene products, respectively (Fig. 1). The primers JMc11
(5'-CCCGGTACCTTTGTGCTAGTTAGAGAATAT-3') and JMc17
(5'-CCCGGTACCATAGTTTTTACCATTGATCCC-3') are based
on the 3' ends of brcI (Fig. 1) and brcB,
respectively, and both contain KpnI restriction sites
(underlined). To construct plasmid pJKM19 (Fig.
2), DNA was amplified from pAP7.4 by
using the primers JMc10 and JMc11 and cloned into the
HindIII and KpnI sites of pRW19e. Plasmids
pJKM36 and pJKM46 (Fig. 2) were constructed in a manner similar to that
for pJKM19 except that the primers used in the PCR were JMc10-JMc17 and
JMc11-JMc29, respectively. An expression clone containing only
brcI was constructed as follows. DNA from pAP7.4 was
amplified by using JMc11 and JMc28 as primers and cloned into the
EcoRI and KpnI sites of pUC118. The primer JMc28
(5'-CGCGAATTCATCGGAAGTATTTGGGATC-3') is based on
the 5' end of brcI and contains an EcoRI
restriction site (underlined). The fragment was subsequently excised
from pUC118 with PstI and KpnI and cloned into
these sites in pMG36e to create pJKM49 (Fig. 2). The forward primer
JMc25 (5'-CGCTCTAGATGGAGGTTGGTATATATG-3') and
reverse primer JMc30
(5'-CGCGAGCTCCTAGTTACCTAATAATCC-3') contained XbaI and SacI sites (underlined), respectively,
and were designed to amplify the
dvn::brcA gene fusion from pJKM19. The
resulting PCR product was cloned into the XbaI and
SacI sites of pUC118 to give pJKM53-1. The two inserts from
pJKM53-1 and pJKM46 were excised and ligated into the XbaI
and KpnI sites of pUC118 and pUC119 to create pJKM61 and
pJKM64, respectively (Fig. 2). The 718-bp fragment from pJKM61 was
excised and cloned into pMG36e in C. piscicola UAL26 to give
plasmid pJKM67 (Fig. 2). DNA amplifications were performed with
AmpliTaq DNA polymerase (Perkin-Elmer, Foster City, Calif.) or
Pfu DNA polymerase (Stratagene, La Jolla, Calif.) by the
suppliers' recommended procedures. All PCR products were sequenced to
confirm the absence of mutations.
0099-2240/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
Genetic Characterization and Heterologous
Expression of Brochocin-C, an Antibotulinal, Two-Peptide Bacteriocin
Produced by Brochothrix campestris ATCC 43754


![]()
ABSTRACT
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References
![]()
INTRODUCTION
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References
![]()
MATERIALS AND METHODS
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References
70°C in APT broth (All Purpose Tween; Difco Laboratories
Inc., Detroit, Mich.) supplemented with 20% (vol/vol) glycerol, except strains of Escherichia coli, which were stored under the
same conditions in Luria-Bertani broth (LB) (29).
Bacteriocin production by B. campestris was studied in APT
broth and semidefined Casamino Acids medium (CAA) (14).
E. coli strains inoculated into LB containing the
appropriate antibiotic were grown with shaking at 37°C. Transformants
of E. coli were selected on either LB or yeast
extract-tryptone agar (Difco) with selective concentrations of
ampicillin or erythromycin (200 µg ml
1). For growth of
Carnobacterium transformants, a selective concentration of 5 µg of erythromycin per ml was used.
TABLE 1.
Bacterial strains and plasmids used in this study
(excluding strains used for determination of the antimicrobial
activity spectrum)
60°C) acetone and stored at 5°C for 24 h. The precipitate was separated by centrifugation (13,000 × g for 15 min), dissolved in 10 ml of 0.1% trifluoroacetic
acid (TFA), loaded onto a Sephadex G-50 (Pharmacia) column (2.5 by 120 cm) which was preequilibrated with TFA, and eluted with 0.1% TFA at a
flow rate of 0.6 ml min
1. Absorbance was monitored at 220 nm, and fractions showing antimicrobial activity by the spot-on-lawn
assay (see below) were concentrated and lyophilized. Brochocin-C
preparations were examined on 20% polyacrylamide gels (20).
Electrophoresis was done with a 20-mA constant current for 3 h,
and gels were fixed in 50% methanol-10% acetic acid for 1 h and
stained with Coomassie blue (Bio-Rad) or assayed for antimicrobial
activity by overlayering with Carnobacterium piscicola LV17C
(Table 1) as described by Worobo et al. (40). The purity of
the sample was confirmed by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis and by mass spectral analysis.
1) was prepared in 0.02 N HCl, and it was used at 3,200 AU ml
1 (equivalent to 250 µg of nisin
ml
1, as verified by using C. divergens LV13).
1. Samples were stored at 25 and 4°C for 6 and
24 h and tested for activity.
1.
-32P]ATP (Amersham) and T4 polynucleotide kinase
(Promega) or were nonradioactively labeled by random-primed labeling
with digoxigenin-dUTP (Boehringer-Mannheim).
transformants were screened by
alpha-complementation (39), and colony blots were done to
discriminate the white colonies for the correct DNA insert. Positive
clones were digested with EcoRI and hybridized in a Southern
blot with APO-1 to confirm the presence of the brochocin gene.

View larger version (92K):
[in a new window]

View larger version (87K):
[in a new window]
FIG. 1.
Single-strand DNA sequence of the 4.4-kb
EcoRI fragment of pAP7.4 containing the brochocin-C operon.
The brochocin-C structural (brcA and brcB),
immunity (brcI), and putative transport (brcD and
brcT) genes as well as orf1 and orf2
are shown, with the translation products given above the nucleotide
sequence. Potential RBSs and putative
35 and
10 regions are
indicated. An inverted repeat with the potential to function as a
transcription terminator is indicated by converging arrows.

View larger version (29K):
[in a new window]
FIG. 2.
Genetic organization of the 4.4-kb EcoRI
fragment encoding the brochocin-C operon and various expression clones.
pJKM19, pJKM36, and pJKM46 were constructed in pRW19e to create the
gene fusion with the divergicin A signal peptide. pJKM49, pJKM56, and
pJKM67 were constructed by cloning the appropriate fragments in pMG36e.
pJKM61 and pJKM64 were constructed by cloning the appropriate fragments
in pUC118 and pUC119, respectively. Promoters controlling the
expression of each plasmid are shown.
Nucleotide sequence accession number. The nucleotide sequence reported here has been submitted to GenBank and given accession no. AF075600.
| |
RESULTS |
|---|
|
|
|---|
Inhibitory spectrum of B. campestris.
Purification of
brochocin-C yielded stock supplies with 25,600 AU of brochocin-C per
ml. This was diluted to give solutions with 100 or 800 AU
ml
1 (based on its activity against C. divergens LV13) for use in spot-on-lawn assays. As shown in Table
2, deferred-inhibition and spot-on-lawn
tests with 800 AU of brochocin-C per ml gave the best and almost
equivalent inhibitory spectra. Brochocin-C was also active against
vegetative cells and spores of strains of Bacillus and
Clostridium spp. Siragusa and Nettles Cutter (30) did not detect activity against seven strains of gram-negative bacteria. Similarly, no inhibition was observed against 29 strains of
gram-negative bacteria, including Aeromonas hydrophila,
Citrobacter spp., Enterobacter spp., E. coli, Klebsiella spp., Proteus spp., Salmonella (10 serovars), Serratia spp.,
Shewanella putrefaciens, Shigella flexneri, and
Yersinia enterocolitica, as well as Pseudomonas aeruginosa and Pseudomonas fragi. Treatment of E. coli ATCC 25922 and S. choleraesuis ATCC 10708 with
EDTA and nisin resulted in 4.0- and 2.1-log-unit reductions in the
bacterial count, respectively. In the presence of brochocin-C and EDTA,
there were 2.8- and 2.3-log-unit reductions, respectively. Brochocin-C
was active in deferred-inhibition assays against the spores of seven
proteolytic and three nonproteolytic strains of C. botulinum, but only limited inhibition against the vegetative
cells was observed.
|
Production and characteristics of brochocin-C.
B.
campestris ATCC 43754 grown in APT broth at 25°C with an initial
inoculum of 107 CFU ml
1 and a starting pH of
6.5 resulted in detectable bacteriocin production within 3 h.
Maximum bacteriocin production was detected in the stationary phase
after 30 h of incubation. The pH when the population of B. campestris ATCC 43754 was maximal was 5.0, and bacteriocin activity remained stable for up to 48 h at 25°C (data not
shown). Growth in semidefined CAA medium (pH 6.5) without pH adjustment resulted in a fourfold decrease in the maximum level of bacteriocin produced compared with production in APT broth. However, in CAA medium
maintained at constant pH 7.0 with 2 N NaOH throughout the growth
period, there was a fivefold increase in bacteriocin production and a
1-log-unit increase in the maximum cell density. Brochocin-C from
supernatants of B. campestris was thermally stable from pH 2 to 9 when heated at 100°C for 15 min. After 1 week of storage at
4°C, samples heated at 100°C for 15 min still showed the same
levels of bacteriocin activity. After heating at 121°C for 15 min,
there was a decrease in bacteriocin activity from 1,600 to 200 AU
ml
1 at pH 9.0 and from 3,200 to 400 AU ml
1
at pH 8, but at all other pH levels (2 to 7), the activity loss was not
greater than 75%. Partially purified (butanol-extracted) brochocin-C
added at 100 AU ml
1 to APT broth (pH 6.5) and to
phosphate buffer (50 mM, pH 6.5) containing C. piscicola
LV17C at 106 CFU ml
1 was bacteriostatic in
APT broth but bactericidal in phosphate buffer. There was no change in
optical density, which suggests that brochocin-C is not
bacteriolytic to C. piscicola LV17C. The proteinaceous
nature of butanol-extracted brochocin-C (6,400 AU ml
1) was demonstrated by inactivation with papain,
pepsin, pronase E, subtilisin, trypsin, and
-chymotrypsin added at 1 mg ml
1, similar to results of previous work
(30). Activity was not lost in the presence of catalase or
lipase. Butanol-extracted brochocin-C added to organic solvents at 10 AU µl
1 and stored at 25 and 4°C was least stable in
acetonitrile at 25°C, but it was relatively stable at 4°C.
Brochocin-C activity was not affected by ethanol and 0.1% TFA after
24 h of storage at either temperature. A moderate loss of activity
in methanol was observed.
Purification of brochocin-C. A 5-liter fermentation culture of B. campestris ATCC 43754 grown in CAA medium for 22 h at constant pH 6.7 was used for purification of the active compound. This compound was extracted from the supernatant by butanol extraction, acetone precipitation, and size exclusion chromatography (Table 3). Staining of the gel after sodium dodecyl sulfate-polyacrylamide gel electrophoresis showed only one band that correlated with a zone of inhibition that was observed when the gel was overlayered with C. piscicola LV17C (data not shown).
|
Genetic characterization of brochocin-C. Biochemical and genetic information revealed that brochocin-C was a two-peptide bacteriocin (BrcA and BrcB) and that we had purified BrcA. The N-terminal amino acid sequence of BrcA was determined by automated Edman degradation. This revealed the first 48 amino acid residues from the N terminus: YSSKDCLKDIGKGIGAGTVAGAAGGGLAAGLGAIPGAFVGAHF GVIGG. The molecular weight determined by mass spectrometry was 5,241.2 ± 1.2. The structural gene corresponding to the purified BrcA was identified by both colony blot and Southern hybridizations. Plasmid and genomic DNAs from B. campestris were digested with EcoRI, blotted onto a nylon membrane, and hybridized with the labeled probe APO-1 at 29°C. Unique bands of the plasmid and the genomic DNA digests gave hybridization signals (data not shown). Increasing the stringency of hybridization resulted in loss of the signal for both plasmid and genomic DNAs. Cloning and sequencing of the 1.6-kb EcoRI DNA fragment from the plasmid DNA that hybridized to APO-1 revealed that this was nonspecific hybridization (data not shown).
Subsequently, a 4.4-kb chromosomal DNA fragment that hybridized to APO-1 was detected. This fragment was cloned into the EcoRI site of pUC118 to create pAP7.4. The nucleotide sequence of the 4.4-kb fragment of pAP7.4 is shown in Fig. 1. This revealed the sequence corresponding to APO-1 within an ORF corresponding to the structural gene (brcA) of BrcA and consisted of 231 bp encoding a primary translation product of 77 amino acid residues. The translation product of the brcA gene contained all 48 of the N-terminal amino acids of BrcA previously identified by N-terminal amino acid sequencing. The sequence indicated that there would be cleavage of the polypeptide chain to release an 18-amino-acid leader peptide and a 59-amino-acid mature bacteriocin. The leader peptide closely resembled the double-glycine-type leader peptides that are found in many class II bacteriocins (9, 15, 18). At positions
4,
7,
12, and
15 of the leader peptide there are the hydrophobic residues and at
position
8 there is the highly conserved glutamic acid residue that
are characteristic of leader peptides of class II bacteriocins (9,
15). A putative promoter and a ribosome binding site (RBS) were
detected upstream of this structural gene. The molecular weight of the
mature BrcA product identified by nucleotide sequencing was calculated
to be 5,245, which is in good agreement with the mass spectrometry result if two cysteines in the molecule form a disulfide bridge. The
uncertainty about the cysteine residue at position 6 from the results
of Edman degradation was resolved by nucleotide sequencing of the gene;
a second cysteine residue was found at position 52 of the peptide. The
difference between the calculated and determined (5,241.2 ± 1.2)
molecular weights indicates a disulfide link between the two cysteines,
as has been observed for a number of other class II bacteriocins
(18).
Directly downstream of brcA there is a second ORF,
brcB, that is preceded by an RBS. The translation product of
this ORF starts with a sequence of 17 amino acids that resembles a
probable leader peptide of the double-glycine type. There are
hydrophobic residues similar to those in BrcA at positions
4,
7,
and
12, as well as a glutamic acid residue at position
8. The
leader sequence is followed by 43 amino acid residues that could
constitute the second peptide of a two-component bacteriocin.
Hydropathy plots (19) of the mature BrcA and BrcB peptides
showed a charged N terminus, but otherwise the peptides were strongly
hydrophobic (data not shown). A homology search in the data bank
revealed that the mature peptides BrcA and BrcB have 59 and 49%
identity with ThmA and ThmB, respectively, which together form the
two-component bacteriocin thermophilin 13 from Streptococcus
thermophilus (22).
A third ORF, brcI, with an RBS was detected downstream of
and overlapping the 3' end of brcB. This suggests the
possibility of translational coupling (1). The translation
product of brcI would contain 53 amino acid residues and
does not contain a double-glycine-type leader peptide. BrcI showed 21%
identity to the translation product of ORFC, which is located
immediately downstream of the structural gene for ThmB (22).
The ORFC product had 59% similarity with BrcI when conserved amino
acid substitutions were included. The similarities between BrcI and the
ORFC product do not relate to specific regions of the proteins but
occur generally over the entire molecules. Downstream of
brcI is an imperfect inverted repeat that might function as
a rho-independent terminator. This palindromic structure is
followed by a putative promoter sequence and two ORFs, brcD
and brcT, that encode proteins that resemble dedicated
transport proteins found for other class II bacteriocins, such as
lactococcin A, pediocin PA-1, and leucocin A (23, 33, 35).
brcD encodes a polypeptide of 158 amino acids. A homology search in the GenBank database revealed that it had 24% identity and,
when conserved residue substitutions are considered, 56% similarity
with PedC, the accessory protein involved in the secretion of pediocin
PA-1 (23). The 3' end of the brcT gene is
truncated due to the location of the EcoRI site used to
clone this fragment. The translational product of the 5' end of
brcT showed the highest homology with the cbnT
product, the ABC transporter of carnobacteriocin B2 (49% identity),
indicating that BrcT belongs to the family of ATP-binding cassette
(ABC) transporters (27). Two ORFs (designated orf1 and orf2) were located upstream of the
brcABIDT gene cluster. The translational product of 132 amino acids from the 5'-end-truncated orf1 shows 41%
identity to ISAS30, a transposase from Aeromonas salmonicida that belongs to the IS30 family of
insertion sequence elements (13). The polypeptide of 100 amino acids encoded by orf2 has a hydrophobic N terminus and
a pI of 10 and shows no similarity to any known proteins.
Expression of BrcA and BrcB in heterologous hosts. Previous work established that class II bacteriocins could be produced in lactic acid bacteria by replacing the double-glycine-type leader with a signal peptide to allow for export of active bacteriocin via the general protein secretory pathway (24). By using this strategy, expression clones were constructed to examine the roles of brcA and brcB individually or in combination. All of these constructs were based on the expression vector pMG36e (Table 1), and transcription was under control of the lactococcal P32 promoter. The signal peptide used in these constructs was from divergicin A (40).
To examine the extracellular role of the brcA gene product, a truncated brcA gene lacking the nucleotide sequence encoding the double-glycine-type leader peptide was fused to DNA encoding the divergicin A signal peptide of pRW19e. The resulting plasmid, pJKM19, also contained intact brcB and brcI genes. When C. divergens LV17C containing pJKM19 was analyzed by the deferred-inhibition assay, a zone of inhibition against C. divergens LV17C containing pMG36e was evident (Fig. 3). Similar results were obtained with C. piscicola LV13 (data not shown). A zone of inhibition was detected from these clones, and it was initially attributed to the activity of secreted BrcA, because the BrcB peptide would not be exported in the absence of dedicated transport proteins, although the brcB gene is present in this construct. pJKM36 was constructed in a manner similar to that for pJKM19 except that it lacked the brcI gene (Fig. 2). Strains containing pJKM36 produced a zone of inhibition similar to that of strains containing pJKM19; however, these clones grew poorly, and when used as indicators, immunity to brochocin-C was not expressed (data not shown). This indicated that the product of the brcI gene was most probably involved in immunity.
|
-D-thiogalactopyranoside) was lethal to the
resulting E. coli XL1-Blue transformants containing pJKM64.
The insert from pJKM61 was excised and cloned into pJMG36e by
transforming the ligation mixture into C. piscicola UAL26, giving plasmid pJKM67. Transformants containing pJKM67 produced zones
of inhibition when overlayered with C. piscicola UAL26
containing pMG36e. However, when they were overlayered with C. piscicola UAL26 containing pJKM19 or pJKM46, both of which contain
the brochocin-C immunity gene, zones of inhibition were no longer
present (data not shown). Plasmid pJKM67 was used to transform C. piscicola LV17C, and all of the transformants produced zones
of inhibition similar to that of C. piscicola UAL26
containing pJKM67 (Fig. 3).
| |
DISCUSSION |
|---|
|
|
|---|
Brochocin-C is a two-peptide class IIb bacteriocin (18) with a broad spectrum that compares favorably with the antibacterial spectrum of nisin, inhibiting the outgrowth of Bacillus and Clostridium spores, including spores of C. botulinum. This is exceptional because the structure of brochocin-C is not comparable to that of nisin. Nisin does not require a receptor to permeabilize the membranes of sensitive cells, and it inhibits gram-negative bacteria pretreated with EDTA (32). Brochocin-C was also active against E. coli and S. choleraesuis cells treated with EDTA, although the degree of inhibition that we observed for nisin and brochocin-C was less than that reported for nisin by Stevens et al. (32). This suggests that brochocin-C also does not require a receptor to be active. Plasmid pJKM64 is lethal in E. coli when Sec-dependent production of brochocin-C is introduced, and this provides further evidence that brochocin-C is active in E. coli and does not need a receptor. Thermophilin 13 is a bacteriocin that is very similar in structure to brochocin-C, and it was shown to dissipate the proton motive force in liposomes, indicating that a receptor is not required for activity of this bacteriocin (22).
In addition to the heat stability of brochocin-C at 100°C previously reported by Siragusa and Nettles Cutter (30), we showed that activity is maintained from pH 2 to 9 with heating at 100°C. These characteristics make brochocin-C worth studying for its potential as a food preservative. B. campestris ATCC 43754 was isolated as a soil microorganism (34), and it can be assumed to be present in meats based only on its close relationship to B. thermosphacta. The only traits that separate these two species are that B. thermosphacta grows in the presence of and reduces 0.05% potassium tellurite and that B. campestris hydrolyzes hippurate and produces acid from rhamnose. Also, B. thermosphacta grows in media containing up to 10% NaCl. Because of its similarities to B. thermosphacta and its relatively recent description (34), it is possible that strains of B. campestris were previously misidentified as B. thermosphacta.
Attempts to purify brochocin-C by the method described for leucocin A (14) proved unsuccessful because large losses in activity occurred after passage over the Amberlite XAD-8 hydrophobic interaction column and reverse-phase high-pressure liquid chromatography with a C18 column (data not shown). A gradient of 0.1% TFA with acetonitrile did not give discernible peaks associated with the biologically active fractions. Siragusa and Nettles Cutter (30) reported that the compound was partially purified by ammonium sulfate fractionation; however, in our study, ammonium sulfate precipitation produced a floating film that contained a significant amount of activity, similar to the phenomenon encountered with lactacin F (25). Purification of BrcA was achieved with butanol extraction of the supernatant fluids and size exclusion chromatography.
Following N-terminal amino acid sequencing of the pure compound, an appropriate oligonucleotide probe that gave an intense hybridization signal with B. campestris plasmid DNA was synthesized, leading to the nucleotide sequencing of the 1.6-kb EcoRI fragment associated with the signal, but the BrcA structural gene was not located on this fragment. The false-positive signal might be attributed to a higher copy number of plasmid DNA with a remotely similar sequence, compared with the single copy of the structural gene on the chromosome. The genomic DNA fragment that hybridized to the probe was subsequently cloned, its nucleotide sequence was determined, and an ORF corresponding to the structural gene for BrcA was found. The amino acid sequence corresponding to the purified BrcA peptide was typical of double-glycine-type leader peptides of class II bacteriocins (9, 15, 18). The second ORF detected directly downstream of the BrcA structural gene encoded a 60-amino-acid peptide which contained a putative 17-amino-acid double-glycine-type leader peptide. The double-glycine-type leader peptides are required to direct secretion of bacteriocins by dedicated ABC transporters that are cleaved after the double glycine residues to release the mature peptides (36). Using the results of our previous work (24), we showed that by fusing the signal peptide of divergicin A in place of the double-glycine-type leader peptides, secretion of separate components was achieved by use of the Sec-dependent export pathway. This demonstrated the two-component nature of brochocin-C.
Individually, transformants of carnobacteria producing either the BrcA or the BrcB peptide were not active against the indicators tested in this study, because both components are required for activity of the bacteriocin complex. The reason why purified BrcA peptide showed antibacterial activity might be that small amounts of contaminating BrcB are present in the purified BrcA sample due to the hydrophobic nature of the peptides. It is also possible that high concentrations of BrcA have antimicrobial activity, as shown for high concentrations of ThmA (22). This would be similar to the two-component bacteriocin lactacin F from Lactobacillus johnsonii. LafA is active against one of six strains normally sensitive to the lactacin F bacteriocin (3). When expressed individually, the second component of this bacteriocin (LafX) lacked activity; however, when LafX was concentrated, antimicrobial activity was detected. It remains unclear why transformants containing pJKM19 showed antimicrobial activity. One explanation might be that the strains of carnobacteria used in this study contain chromosomally encoded transport proteins homologous to the dedicated transport proteins of brochocin-C that are responsible for the secretion of BrcB. Heterologous bacteriocin production by secretion proteins encoded on the chromosome has also been described for L. lactis IL1403 (38). It is also possible that zones of inhibition produced by transformants containing pJKM19 resulted from leakage of unprocessed BrcB from lysed cells, which would complement BrcA for antimicrobial activity.
The third ORF (brcI) encodes the immunity protein for brochocin-C. This gene encodes a 53-amino-acid protein, and its expression alone from pJKM49 restored some immunity but not to wild-type levels. However, both of the expression clones pJKM19 and pJKM46 restored full immunity. The overlap of the 3' end of brcB with the 5' end of brcI hints at the possibility of translational coupling between these two genes (1). This model suggests that when translation terminates, the ribosome either may dissociate from the mRNA or may scan the mRNA in both upstream and downstream directions to reinitiate translation in response to an encounter with a functional start site. The RBS of brcI (GGAAG) is atypical in that it lies 12 nucleotides upstream of the ATG initiation codon. The brcI gene in pJKM49 may not be transcribed as efficiently as those in pJKM19 and pJKM46, explaining the partial immunity to brochocin-C of strains containing this plasmid. Downstream of the immunity gene, two genes were found, brcT and brcD, that most likely encode the dedicated transport apparatus for brochocin-C. The putative accessory transport protein for brochocin-C, BrcD, is homologous to the accessory protein (PedC) for pediocin PA-1/AcH. These two proteins are generally smaller than accessory proteins for other class II bacteriocins, i.e., 158 versus 450 amino acids (6, 23). Furthermore, brcD preceeds the gene for the putative ABC transporter protein, brcT, as reported for pediocin PA-1/AcH (6, 23).
Despite its broad spectrum of activity and potency, further research is required to determine the potential of brochocin-C for use in food systems. For example, it is necessary to determine whether this bacteriocin is inactivated by proteolytic enzymes in foods and whether it is bound to and inactivated by other food constituents. A key requirement for use of brochocin-C in foods is a means of effectively delivering the bacteriocin. Even if brochocin-C production in a gene cassette in a food grade organism proves unsuccessful for meat preservation, this system could also serve as a model for protein engineering of other class II bacteriocins in food systems.
| |
ACKNOWLEDGMENTS |
|---|
We are grateful for the technical advice given by Randy Worobo and Lynn Elmes.
This research was funded by a strategic grant from the Natural Sciences and Engineering Research Council (NSERC) of Canada.
| |
FOOTNOTES |
|---|
* Corresponding author. Mailing address: Department of Agricultural, Food and Nutritional Science, 4-10 Ag/For Centre, University of Alberta, Edmonton, Alberta, Canada T6G 2P5. Phone: (403) 492 2386. Fax: (403) 492 8914. E-mail: mstiles{at}afns.ualberta.ca.
Present address: Department of Microbiology, University of
Minnesota Medical School, Minneapolis, MN 55455.
Present address: Apotex Fermentations, Winnipeg, Manitoba, Canada
R3Y 1G4.
| |
REFERENCES |
|---|
|
|
|---|
| 1. | Adhin, M. R., and J. van Duin. 1990. Scanning model for translational reinitiation in eubacteria. J. Mol. Biol. 213:811-818[Medline]. |
| 2. |
Ahn, C., and M. E. Stiles.
1990.
Plasmid-associated bacteriocin production by a strain of Carnobacterium piscicola from meat.
Appl. Environ. Microbiol.
56:2503-2510 |
| 3. |
Allison, G. E.,
C. Fremaux, and T. R. Klaenhammer.
1994.
Expansion of bacteriocin activity and host range upon complementation of two peptides encoded within the lactacin F operon.
J. Bacteriol.
176:2235-2241 |
| 4. |
Barefoot, S. F., and T. R. Klaenhammer.
1983.
Detection and activity of lactacin B, a bacteriocin produced by Lactobacillus acidophilus.
Appl. Environ. Microbiol.
45:1808-1815 |
| 5. | Blickstad, E., and G. Molin. 1984. Growth and end-product formation in fermenter cultures of Brochothrix thermosphacta ATCC 11509 and two psychrotrophic Lactobacillus spp. in different gaseous atmospheres. J. Appl. Bacteriol. 57:213-220[Medline]. |
| 6. |
Bukhtiyarova, M.,
R. Yang, and B. Ray.
1994.
Analysis of the pediocin AcH gene cluster from plasmid pSMB74 and its expression in a pediocin-negative Pediococcus acidilactici strain.
Appl. Environ. Microbiol.
60:3405-3408 |
| 7. | Casadaban, M. J., and S. N. Cohen. 1980. Analysis of gene control signals by DNA fusion and cloning in Escherichia coli. J. Mol. Biol. 138:179-207[Medline]. |
| 8. | Delves-Broughton, J. 1990. Nisin and its uses as a food preservative. Food Technol. 44(11):100, 102, 104, 106, 108, 111, 112, 117. |
| 9. |
Fremaux, C.,
C. Ahn, and T. R. Klaenhammer.
1993.
Molecular analysis of the lactacin F operon.
Appl. Environ. Microbiol.
59:3906-3915 |
| 10. | Gardner, G. A. 1981. Brochothrix thermosphacta (Microbacterium thermosphactum) in the spoilage of meats: a review, p. 139-173. In T. A. Roberts, G. Hobbs, J. H. B. Christian, and N. Skovgaard (ed.), Psychrotrophic microorganisms in spoilage and pathogenicity. Academic Press, Toronto, Canada. |
| 11. |
Grau, F. H.
1980.
Inhibition of the anaerobic growth of Brochothrix thermosphacta by lactic acid.
Appl. Environ. Microbiol.
40:433-436 |
| 12. | Grau, F. H. 1988. Substrates used by Brochothrix thermosphacta when growing on meat. J. Food Prot. 51:639-642. |
| 13. | Gustafson, C. E., S. Chu, and T. J. Trust. 1994. Mutagenesis of the paracrystalline surface protein array of Aeromonas salmonicida by endogenous insertion elements. J. Mol. Biol. 237:452-463[Medline]. |
| 14. |
Hastings, J. W.,
M. Sailer,
K. Johnson,
K. L. Roy,
J. C. Vederas, and M. E. Stiles.
1991.
Characterization of leucocin A-UAL 187 and cloning of the bacteriocin gene from Leuconostoc gelidum.
J. Bacteriol.
173:7491-7500 |
| 15. |
Håvarstein, L. S.,
H. Holo, and I. F. Nes.
1994.
The leader peptide of colicin V shares consensus sequences with leader peptides that are common among peptide bacteriocins produced by gram-positive bacteria.
Microbiology
140:2383-2389 |
| 16. | Health Protection Branch, Health and Welfare Canada. 1989. Compendium of analytical methods. Official methods of microbiological analysis of Foods, vol. 1 to 4. Polyscience Publications Inc., Ottawa, Canada. |
| 17. | Henning, S., R. Metz, and W. P. Hammes. 1986. Studies on the mode of action of nisin. Int. J. Food Microbiol. 3:121-134. |
| 18. | Klaenhammer, T. R. 1993. Genetics of bacteriocins produced by lactic acid bacteria. FEMS Microbiol. Rev. 12:39-86[Medline]. |
| 19. | Kyte, J., and R. F. Doolittle. 1982. A simple method for displaying the hydropathic character of a protein. J. Mol. Biol. 157:105-132[Medline]. |
| 20. | Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature (London) 227:680-685[Medline]. |
| 21. | Lowry, O. H., N. J. Rosebrough, A. L. Farr, and R. J. Randall. 1951. Protein measurement with the Folin phenol reagent. J. Biol. Chem. 193:256-275. |
| 22. |
Marciset, O.,
M. C. Jeronimus-Stratingh,
B. Mollet, and B. Poolman.
1997.
Thermophilin 13, a nontypical antilisterial poration complex bacteriocin, that functions without a receptor.
J. Biol. Chem.
272:14277-14284 |
| 23. |
Marugg, J. D.,
C. F. Gonzalez,
B. S. Kunka,
A. M. Ledeboer,
M. J. Pucci,
M. Y. Toonen,
S. A. Walker,
L. C. M. Zoetmulder, and P. A. Vandenbergh.
1992.
Cloning, expression, and nucleotide sequence of genes involved in the production of pediocin PA-1, a bacteriocin from Pediococcus acidilactici PAC1.0.
Appl. Environ. Microbiol.
58:2360-2367 |
| 24. | McCormick, J. K., R. W. Worobo, and M. E. Stiles. 1996. Expression of the antimicrobial peptide carnobacteriocin B2 by a signal peptide-dependent general secretory pathway. Appl. Environ. Microbiol. 62:4095-4099[Abstract]. |
| 25. |
Muriana, P. M., and T. R. Klaenhammer.
1991.
Purification and partial characterization of lactacin F, a bacteriocin produced by Lactobacillus acidophilus 11088.
Appl. Environ. Microbiol.
57:114-121 |
| 26. |
Pearson, W. R., and D. J. Lipman.
1988.
Improved tools for biological sequence comparison.
Proc. Natl. Acad. Sci. USA
85:2444-2448 |
| 27. |
Quadri, L. E. N.,
M. Kleerebezem,
O. P. Kuipers,
W. M. de Vos,
K. L. Roy,
J. C. Vederas, and M. E. Stiles.
1997.
Characterization of a locus from Carnobacterium piscicola LV17B involved in bacteriocin production and immunity: evidence for global inducer-mediated transcriptional regulation.
J. Bacteriol.
179:6163-6171 |
| 28. |
Quadri, L. E. N.,
M. Sailer,
K. L. Roy,
J. C. Vederas, and M. E. Stiles.
1994.
Chemical and genetic characterization of bacteriocins produced by Carnobacterium piscicola LV17B.
J. Biol. Chem.
269:12204-12211 |
| 29. | Sambrook, J., E. F. Fritsch, and T. Maniatis. 1989. Molecular cloning: a laboratory manual, 2nd ed. Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. |
| 30. |
Siragusa, G. R., and C. Nettles Cutter.
1993.
Brochocin-C, a new bacteriocin produced by Brochothrix campestris.
Appl. Environ. Microbiol.
59:2326-2328 |
| 31. | Southern, E. M. 1975. Detection of specific sequences among DNA fragments separated by gel electrophoresis. J. Mol. Biol. 98:503-517[Medline]. |
| 32. |
Stevens, K. A.,
B. W. Sheldon,
N. A. Klapes, and T. R. Klaenhammer.
1991.
Nisin treatment for inactivation of Salmonella species and other gram-negative bacteria.
Appl. Environ. Microbiol.
57:3613-3615 |
| 33. |
Stoddard, G. W.,
J. P. Petzel,
M. J. van Belkum,
J. Kok, and L. L. McKay.
1992.
Molecular analysis of the lactococcin A gene cluster from Lactococcus lactis subsp. lactis biovar. diacetylactis WM4.
Appl. Environ. Microbiol.
58:1952-1961 |
| 34. |
Talon, R.,
P. A. D. Grimont,
F. Grimont,
F. Gasser, and J. M. Boeufgras.
1988.
Brochothrix campestris sp. nov.
Int. J. Syst. Bacteriol.
38:99-102 |
| 35. | van Belkum, M. J., and M. E. Stiles. 1995. Molecular characterization of genes involved in the production of the bacteriocin leucocin A from Leuconostoc gelidum. Appl. Environ. Microbiol. 61:3573-3579[Abstract]. |
| 36. | van Belkum, M. J., R. W. Worobo, and M. E. Stiles. 1997. Double-glycine-type leader peptides direct secretion of bacteriocins by ABC transporters: colicin V secretion in Lactococcus lactis. Mol. Microbiol. 23:1293-1301[Medline]. |
| 37. |
van de Guchte, M.,
J. M. B. M. van der Vossen,
J. Kok, and G. Venema.
1989.
Construction of a lactococcal expression vector: expression of hen egg white lysozyme in Lactococcus lactis subsp. lactis.
Appl. Environ. Microbiol.
55:224-228 |
| 38. | Venema, K., M. H. R. Dost, P. A. H. Beun, A. J. Haandrikman, G. Venema, and J. Kok. 1996. The genes for secretion and maturation of lactococcins are located on the chromosome of Lactococcus lactis IL1403. Appl. Environ. Microbiol. 62:1689-1692[Abstract]. |
| 39. | Vieira, J., and J. Messing. 1982. The pUC plasmids, an M13mp7-derived system for insertion mutagenesis and sequencing with synthetic universal primers. Gene 19:259-268[Medline]. |
| 40. |
Worobo, R. W.,
M. J. van Belkum,
M. Sailer,
K. L. Roy,
J. C. Vederas, and M. E. Stiles.
1995.
A signal peptide secretion-dependent bacteriocin from Carnobacterium divergens.
J. Bacteriol.
177:3143-3149 |
| 41. |
Young, I. E., and P. C. Fitz-James.
1959.
Chemical and morphological studies of bacterial spore formation. II. Spore and parasporal protein formation in Bacillus cereus var. alesti.
J. Biophys. Biochem. Cytol.
6:483-498.
|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»