This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Cokesa, Z.
Right arrow Articles by Rieger, P.-G.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Cokesa, Z.
Right arrow Articles by Rieger, P.-G.
Agricola
Right arrow Articles by Cokesa, Z.
Right arrow Articles by Rieger, P.-G.

 Previous Article  |  Next Article 

Applied and Environmental Microbiology, July 2004, p. 3941-3947, Vol. 70, No. 7
0099-2240/04/$08.00+0     DOI: 10.1128/AEM.70.7.3941-3947.2004
Copyright © 2004, American Society for Microbiology. All Rights Reserved.

Biodegradation of All Stereoisomers of the EDTA Substitute Iminodisuccinate by Agrobacterium tumefaciens BY6 Requires an Epimerase and a Stereoselective C-N Lyase

eljko Cokesa, Hans-Joachim Knackmuss, and Paul-Gerhard Rieger*

Institut für Mikrobiologie, Universität Stuttgart, 70569 Stuttgart, Germany

Received 1 December 2003/ Accepted 2 April 2004


arrow
ABSTRACT
 
Biodegradation tests according to Organization for Economic Cooperation and Development standard 301F (manometric respirometry test) with technical iminodisuccinate (IDS) revealed ready biodegradability for all stereoisomers of IDS. The IDS-degrading strain Agrobacterium tumefaciens BY6 was isolated from activated sludge. The strain was able to grow on each IDS isomer as well as on Fe2+-, Mg2+-, and Ca2+-IDS complexes as the sole carbon, nitrogen, and energy source. In contrast, biodegradation of and growth on Mn2+-IDS were rather scant and very slow on Cu2+-IDS. Growth and turnover experiments with A. tumefaciens BY6 indicated that the isomer R,S-IDS is the preferred substrate. The IDS-degrading enzyme system isolated from this organism consists of an IDS-epimerase and a C-N lyase. The C-N lyase is stereospecific for the cleavage of R,S-IDS, generating D-aspartic acid and fumaric acid. The decisive enzyme for S,S-IDS and R,R-IDS degradation is the epimerase. It transforms S,S-IDS and R,R-IDS into R,S-IDS. Both enzymes do not require any cofactors. The two enzymes were purified and characterized, and the N-termini were sequenced. The purified lyase and also the epimerase catalyzed the transformation of alkaline earth metal-IDS complexes, while heavy metal-IDS complexes were transformed rather slowly or not at all. The observed mechanism for the complete mineralization of all IDS isomers involving an epimerase offers an interesting possibility of funneling all stereoisomers into a catabolic pathway initiated by a stereoselective lyase.


arrow
INTRODUCTION
 
Synthetic D,L-aspartic-N-(1,2-dicarboxyethyl)tetrasodiumsalt, also known as sodium iminodisuccinate (IDS), belongs to the group of aminopolycarboxylate chelating agents. IDS is a medium-strong chelator that is able to replace EDTA when rather moderate chelating agents are sufficient for masking alkaline earth or heavy metal ions. The most commonly used chelator, EDTA, is of major concern because of its persistence in conventional wastewater treatment system. Because of its versatile use, large amounts of EDTA are readily released into the aquatic environment (5). Accumulated EDTA in water has the potential to remobilize toxic heavy metals in aqueous sediments or infiltration areas (15, 16). Thus, remobilization could cause heavy metal contamination in drinking water. Successful biodegradation of EDTA was observed only under laboratory conditions by special strains (12, 14, 24). For Fe3+-EDTA, the only known natural attenuation is photodegradation (10).

IDS as a substitute for EDTA is used in a variety of applications, including detergent formulations, corrosion inhibitors, production of pulp and paper, textiles, ceramics, photochemical processes, and as trace nutrient fertilizers in agriculture. It is effective as a bleaching agent stabilizer (H2O2), water softener, and deposit remover, with a superior ecological profile (2).

Sodium iminodisuccinate is produced from maleic anhydride, water, sodium hydroxide, and ammonia. This route yields a mixture of stereoisomers consisting of 25% S,S-IDS, 25% R,R-IDS, and 50% of the meso-form R,S-IDS (20). It is a so-called pentadentate chelating ligand. The chelation involves the four carboxylate groups and the nitrogen atom. It forms an octahedral complex conditional upon occupation of the sixth coordination position by a water molecule (3).

In the present work, we describe a two-enzyme system from Agrobacterium tumefaciens BY6 that catalyzes the key reaction in the degradation of all IDS isomers.


arrow
MATERIALS AND METHODS
 
IDS test samples and chemicals.
The tetrasodium iminodisuccinate isomer mixture, or technical IDS (Baypure CX 100, solid), contained 50% R,S-IDS, 25% S,S-IDS, and 25% R,R-IDS. The amount of iminodisuccinic acid sodium salt was at minimum 65%, and the solid content (sum of sodium salts) was at minimum 85%.

The isomeric purity of the S,S-IDS test sample was 100%, whereas the R,R-IDS sample was 94.2% pure (with 4.1% R,S-IDS and 1.7% fumaric acid). The R,S-IDS sample was 94.9% pure (containing 4% H2O and 1.1% R,R-IDS plus S,S-IDS). The aqueous IDS stock solutions were neutralized to pH 7.0 with either hydrochloric acid or sodium hydroxide.

R,S-IDS, S,S-IDS, and R,R-IDS as well as technical IDS were gifts from Bayer AG (Leverkusen, Germany). All other chemicals were of analytical grade and were obtained from Aldrich (Steinheim, Germany), Fluka (Neu-Ulm, Germany), Merck (Darmstadt, Germany), Roth (Karlsruhe, Germany), or Sigma (Deisenhofen, Germany).

Biodegradation test.
The biodegradation test was performed as described in the Organization for Economic Cooperation and Development (OECD) guideline for testing chemicals by manometric respirometry test 301F (17). The test was carried out with the OxiTop Control system (WTW, Weilheim, Germany). The activated sludge inoculum was obtained from the Bürrig wastewater treatment plant (Leverkusen, Germany), which is a combined industrial-municipal plant. The chemical oxygen demand was determined with test system LCK 314 (Dr. Lange, Düsseldorf, Germany).

Bacterial strain and growth conditions.
A. tumefaciens BY6 was isolated from activated sludge of the Bürrig wastewater treatment plant and identified by 16S ribosomal DNA sequencing.

For isolation, growth, and batch experiments, a mineral salts medium without nitrogen was used, containing (per liter) 20 mg of Fe(III)-citrate, 1 g of MgSO4 · 7H2O, 50 mg of CaCl2 · 2H2O, and 0.1% (vol/vol) trace element solution (18). The mineral salts medium was buffered with 50 mM Na+/K+-phosphate buffer (pH 7.4) and contained 5 to 20 mM IDS as the sole source of carbon, nitrogen, and energy. Solid media were prepared by the addition of 1.5% (wt/vol) agar.

The cells were grown in baffled 3-liter Erlenmeyer flasks containing medium in volumes up to 30% of the flask volume on a rotary shaker at 125 rpm and room temperature (approximately 23°C). The cells were harvested by centrifugation immediately after complete consumption of IDS at an optical density of 1.5 to 2.5 at 546 nm. The pellet was washed twice with 0.05 M Tris-HCl (pH 8.0). Cells were frozen in liquid nitrogen and stored at –30°C until use.

Preparation of cell extract.
Frozen cell paste (15 to 30 g, wet weight) was thawed at room temperature and resuspended in 40 ml of 0.05 M Tris-HCl (pH 8.0). The cell suspension was treated with 30 mg of lysozyme (Fluka, Neu-Ulm, Germany) for 1 h at 23°C and thereafter overnight at 6°C. The cells were then disrupted by four passages through a French press (SLM Aminco, Urbana, Ill.) at 7 MPa. After the first passage, 10 mg of DNase I (ICN Biomedicals) was added. The suspension was kept on ice after each passage. Cell debris was removed by centrifugation at 100,000 x g and 4°C for 45 min. The resulting cell extract was filtered through a 0.22-µm-pore-size filter and finally used for enzyme assays and protein purification.

Purification of the carbon-nitrogen lyase (C-N lyase) and the IDS-epimerase.
The cell extract was dialyzed overnight at 6°C (dialysis tubing size 3; molecular weight cutoff, 12 to 14 kDa; Medicell Int. Ltd.) against 0.05 M Tris-HCl (pH 8.0) and then applied to an anion exchange column (Q Sepharose HR, 1.6 by 10 cm; Pharmacia, Uppsala, Sweden) preequilibrated with 0.05 M Tris-HCl buffer (pH 8.0) at a flow rate of 1.5 ml min–1. In order to optimize the separation of the two enzymes on the anion exchange column, the purification was done by stepwise elution.

Purification of the C-N lyase.
A linear gradient (150 ml) of 0 to 0.75 M NaCl in 0.05 M Tris-HCl (pH 8.0) was used with a step at 0.325 M NaCl (8 ml). Fractions containing R,S-IDS-degrading activity were eluted at NaCl concentrations of 0.15 M to 0.3 M. The collected fractions were dialyzed as described above and loaded on a second anion exchange column (Mono Q HR, 1.6 by 10 cm; Pharmacia) preequilibrated with 0.05 M Tris-HCl buffer (pH 8.0) at a flow rate of 0.4 ml min–1. The corresponding fractions were eluted from the column by a linear gradient (100 ml) of 0 to 1 M NaCl in 0.05 M Tris-HCl (pH 8.0) at NaCl concentrations of approximately 0.25 to 0.35 M. Ammonium sulfate was added to the combined fractions containing R,S-IDS-degrading activity to a final concentration of 1 M.

Precipitated proteins were removed by centrifugation (5,000 x g, 15 min), and the supernatant was applied to a Phenyl-Superose HR column (1.0 by 10 cm; Pharmacia) preequilibrated with 1 M ammonium sulfate in 0.025 M Tris-HCl (pH 8.5) at a flow rate of 0.75 ml min–1. The enzyme was eluted by a linear gradient (80 ml) of 1 to 0 M ammonium sulfate in 0.025 M Tris-HCl (pH 8.5) at a concentration of 0.625 to 0.55 M. Fractions containing R,S-IDS-degrading activity were pooled and then concentrated with Vivaspin 2 and 6 concentrators (molecular weight cutoff, 10 kDa; Sartorius, Göttingen, Germany). Aliquots of 0.5 ml of the concentrated sample (4 ml) were applied on a gel filtration column (Superose 6 HR 1.0 by 30 cm; Pharmacia) preequilibrated with 2.5 mM K+/Na+-phosphate buffer (pH 7.5) at a flow rate of 1.0 ml min–1. The collected samples were demineralized and thus prepared for loading on a hydroxyapatite column (Bio-Scale CHT-I, 5 ml; Bio-Rad Laboratories, Hercules, Calif.). Fractions containing R,S-IDS-degrading activity were eluted from the column by a linear gradient (50 ml) of 2.5 to 100 mM potassium phosphate buffer (pH 7.5) at salt concentrations of 50 mM.

Purification of the IDS-epimerase.
The IDS-epimerase was obtained from an anion exchange column (Q Sepharose HR, 1.6 by 10 cm; Pharmacia) by a linear gradient (230 ml) of 0 to 1 M NaCl in 0.05 M Tris-HCl (pH 8.0) with a step at 0.3 M NaCl (30 ml). IDS-epimerase activity was measured in the fractions with 0.4 to 0.5 M NaCl. The combined fractions were set to a final concentration of 1 M ammonium sulfate, precipitated proteins were removed by centrifugation (5,000 x g, 15 min), and the supernatant was loaded on a Phenyl-Superose HR column (1.0 by 10 cm; Pharmacia). The column preequilibration and the gradient were performed as described above for the R,S-IDS-degrading enzyme. The epimerase was eluted with 0.7 to 0.55 M ammonium sulfate.

All purification procedures were carried out at 6°C. The protein concentration was estimated by the method of Bradford (4) with bovine serum albumin (Fluka) as the standard. The purification procedure was monitored by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE). The molecular mass of the subunit and the subunit composition of the enzyme were determined with a discontinuous SDS-10% polyacrylamide gel following the protocol of Laemmli (11). The proteins of the low-molecular-weight marker kit (Pharmacia) were used as standards. The gels were stained with Coomassie brilliant blue G-250. The native weights of the two enzymes were determined by analytical gel filtration (Superose 6 HR, 1.0 by 30 cm; Pharmacia). The calibration curve was prepared with the gel filtration calibration kit (Pharmacia) for high- and low-molecular-weight proteins containing the following protein standards: ferritin (450 kDa), catalase (232 kDa), aldolase (158 kDa), and bovine serum albumin (68 kDa). The isoelectric point was analyzed with a PhastSystem (Pharmacia) and PhastGel IEF 3-9 (Pharmacia).

Enzyme assays.
C-N lyase and IDS-epimerase activities were assayed by adding 5 to 10 µl of enzyme to 1.0 ml containing 5 mM R,S-IDS in 0.05 M Tris-HCl (pH 8.0) or 5 mM R,R-IDS in 0.05 M Tris-HCl (pH 8.5), respectively. Aliquots of 100 µl were taken, diluted with 10 µl of copper sulfate (200 mM, pH 1.3, adjusted with phosphoric acid) to terminate the reaction. The activities of IDS-epimerase and the C-N lyase were determined by measuring the disappearance of the appropriate substrate by ion pair chromatography. Enzyme assays were performed at 23°C. For amino acid analysis from the lyase reaction, the enzyme was inactivated by heating (3 min, 100°C) instead of acidification.

Determination of pH, temperature optima, and kinetic parameters.
The enzyme assays were performed as described above. The specific activity was measured at various pHs within the range from 5 to 10. A reaction buffer containing 50 mM Tris buffer (pH 7.5 to 9.0), sodium phosphate buffer (pH 5 to 7), and sodium carbonate buffer (pH 9.0 to 10) was used for the assay. For C-N lyase activity, 5 mM R,S-IDS was used as the substrate, and epimerase activity was tested with 5 mM S,S-IDS. The temperature optima of the two enzymes were determined at pH 8.5.

The kinetic parameters were determined at the pH optimum with various substrate concentrations from 0.25 to 12.5 mM. Data were fitted with the Michaelis-Menten equation, and Vmax was deduced from the initially linear conversion rates. The enzyme assays were performed with 10 µl of purified C-N lyase and 5 µl of IDS-epimerase.

Analytical methods.
For separation of the IDS diastereomers and analysis of the metal-IDS complexes, ion pair chromatography was performed with a Purospher RP18 endcapped column (250 by 4.0 mm; Merck) and an isocratic eluent of 12.5% (vol/vol) methanol in formate buffer (15 mM sodium formate, 5 mM formic acid, and 2 mM tetrabutylammonium hydrogen sulfate). IDS diastereomers were measured as Cu2+ complexes at 240 nm. The metabolite fumaric acid was identified by cochromatography with an authentic sample at 215 nm. Activity towards different metal-IDS complexes was measured after conversion to the respective copper complexes as described previously (7).

The sum of the IDS isomers was measured by a rapid photometric test (7). D- and L-aspartic acid were separated and identified by precolumn derivatization with the FLEC/ADAM system [(+)-1-(9-fluorenyl)ethyl chloroformate/1-aminoadamantane] according to Einarsson and Josefsson (8) on a Grom-Sil FLEC 1 (250 by 4.0 mm; Grom, Herrenberg, Germany). Ammonia concentrations were determined spectrophotometrically by use of a commercial test system (Microquant 14750; Merck, Darmstadt, Germany). The dissolved organic carbon was measured with the micro N/C analyzer (IDC, Langewiesen, Germany).

Quantification of S,S-IDS and R,R-IDS in equilibrium.
The equilibrium composition of the three IDS isomers was determined with the help of a Ralstonia sp. strain SLRS7 cell extract (7). Different concentrations of each IDS isomer (5 to 18.5 mM) were prepared as described above with 10 µl of purified epimerase. Aliquots were taken and measured until the equilibrium was established, approximately 18 to 24 h. Then the assay mixture (500 µl) was heated for 10 min at 100°C to inactivate the IDS-epimerase activity and incubated with the cell extract until R,R-IDS was completely consumed. The cell extract from Ralstonia sp. strain SLRS7 is able to transform the S,S-IDS and R,S-IDS isomers, whereas R,R-IDS remains intact. The S,S-IDS concentration in equilibrium was calculated from the difference between the starting concentration of R,R-IDS plus S,S-IDS and the R,R-IDS remaining after enzymatic treatment.

Conversion of IDS by whole cells.
A. tumefaciens BY6 was grown in mineral salts medium with technical IDS (5 mM) and harvested immediately after complete IDS consumption. The cells were resuspended in phosphate buffer (50 mM; pH 7.4) to an optical density of 3.5 at 546 nm and incubated with a mixture of 7.5 mM R,S-IDS and 7.1 mM S,S-IDS at 23°C on a rotary shaker (125 rpm). The cell suspension was divided into two samples when the maximum rate of R,R-IDS consumption was observed. One sample was incubated further until all IDS was consumed. The other sample was supplemented with R,S-IDS.

Analysis of protein sequences.
Purified proteins, approximately 500 pmol, were blotted onto a polyvinylidene difluoride membrane (ProSorb; Applied Biosystems, Weiterstadt, Germany) and subjected to automatic sequencing (476A Protein Sequencer; Applied Biosystems). Database searches were performed with BLAST (1).

Nucleotide sequence accession number.
The sequence will appear in the GenBank nucleotide sequence database under accession number AY576874.


arrow
RESULTS
 
Biodegradation tests.
A standardized OECD test (301F) was carried out to analyze the biodegradability of the three IDS isomers, technical-grade IDS, and the metal-IDS complexes. As shown in Fig. 1, biodegradation of all IDS isomers and technical IDS attained approximately the level of the reference compound sodium benzoate. Interestingly, for the R,R-IDS isomer, a significant degradation rate was not observed before day 3.



View larger version (21K):
[in this window]
[in a new window]
 
FIG. 1. Manometric respirometry test for biodegradation of technical IDS and the three isomers R,R-IDS, S,S-IDS, and R,S-IDS with activated sludge inoculum from the wastewater treatment plant in Bürrig (Leverkusen, Germany) as inoculum. Sodium benzoate was used as reference compound. Data are expressed as a percentage of the theoretical O2 consumption for complete oxidation.

The pass level for ready biodegradability is reached at 60% of the theoretical O2 consumption in a 10-day window within the 28-day period of the test. The 10-day window begins when the degree of biodegradation has reached 10% of the theoretical O2 consumption and must end before day 28 of the test. Therefore, all IDS isomers and technical IDS (Baypure CX 100) were characterized as readily biodegradable substrates.

For the biodegradation test with metal-IDS complexes, equimolar amounts of each metal and IDS were used. The test was monitored over a period of 42 days. Figure 2 shows that Fe2+-IDS and Ca2+-IDS were readily biodegradable, whereas Mn2+-IDS and Cu2+-IDS revealed 55 and 40% biodegradation after 28 days, respectively. During the test on IDS chelates, precipitation of the corresponding heavy metal hydroxide was observed, indicating liberation of free metal ions.



View larger version (21K):
[in this window]
[in a new window]
 
FIG. 2. Manometric respirometry test for biodegradation of the metal-IDS complexes Ca2+-IDS, Fe2+-IDS, Cu2+-IDS, and Mn2+-IDS with activated sludge from the wastewater treatment plant in Bürrig (Leverkusen, Germany). Sodium benzoate was used as a reference compound. Data are expressed as a percentage of the theoretical O2 consumption for complete oxidation.

Isolation and identification of microorganisms.
The IDS-degrading microorganism in this study was isolated from activated sludge. It was enriched in batch culture with buffered mineral salts medium supplemented with 5 mM R,R-IDS as the sole source of carbon, nitrogen, and energy. The enrichment cultures were incubated in a baffled Erlenmeyer flask on a rotary shaker at 125 rpm and room temperature. The cultures were subcultivated daily for 5 days. Subsequently, the cultures were repeatedly transferred on agar plates also containing 5 mM R,R-IDS until a pure culture (BY6) was isolated. Strain BY6 grew with R,R-IDS as the sole source of carbon, nitrogen, and energy. It was gram negative and oxidase positive and formed motile cocci of 1 to 1.5 µm. Furthermore, strain BY6 was identified by 16S ribosomal DNA sequencing. Sequence alignment with BLAST (1) achieved highest homologies (99%) with A. tumefaciens (accession number D14500) and A. tumefaciens strain CIP111-78 (AJ389897). Thus, the organism was named A. tumefaciens BY6.

Growth of A. tumefaciens BY6 on IDS.
A. tumefaciens BY6 grew in mineral salts medium with each of the three IDS isomers as the sole source of carbon, nitrogen, and energy. The doubling times on R,S-IDS, S,S-IDS, and R,R-IDS at 23°C were 3, 3.3, and 3.8 h, respectively. During growth on R,S-IDS, R,R-IDS, and S,S-IDS, the pH increased as a result of ammonia excretion by the cells. The amount of ammonia released into the medium after 5 days corresponded to approximately 30% ± 5% of the nitrogen contained in IDS (data shown for R,R-IDS in Fig. 3).



View larger version (19K):
[in this window]
[in a new window]
 
FIG. 3. Growth of A. tumefaciens BY6 in 500-ml Erlenmeyer flasks with 100 ml of mineral salts medium containing 4.1 mM R,R-IDS (•) as the sole carbon, nitrogen, and energy source. The culture was inoculated with a 1% (vol/vol) preculture. The incubation temperature was 23°C on a rotary shaker at 125 rpm. Shown are optical density ({circ}), pH ({triangleup}), and ammonia ({blacklozenge}).

In addition, growth of A. tumefaciens BY6 was also possible on different metal-IDS chelates, namely, Mg2+-, Ca2+-, Fe2+-, Cu2+-, and Mn2+-IDS. The complexes with the metal ions were generated by adding their sulfate salts in equimolar amounts to technical IDS. The degradation of metal-IDS complexes was monitored by measuring dissolved organic carbon. Mg2+- and Ca2+-IDS complexes were degraded completely within 3 days, while only 75% of Fe2+-IDS was mineralized in this time span. Complete mineralization of Fe2+-IDS and about 75% mineralization of Mn2+-IDS were achieved within 10 days. In contrast, only about 25% of Cu2+-IDS was mineralized within 10 days (data not shown). Metal hydroxide precipitation was noted during growth on Fe2+-, Cu2+-, and Mn2+-IDS. These results correspond with the observations made during biodegradation tests with metal-IDS complexes.

In order to find out whether different isomers of IDS are simultaneously or sequentially used as growth substrates, A. tumefaciens BY6 was incubated with R,R-IDS plus R,S-IDS. As shown in Fig. 4, these two isomers were not simultaneously consumed during the exponential growth phase. Significant decrease of R,R-IDS did not start until almost all of the R,S-IDS was consumed.



View larger version (20K):
[in this window]
[in a new window]
 
FIG. 4. Growth of A. tumefaciens BY6 in 500-ml Erlenmeyer flasks with 100 ml of mineral salts medium containing 4.7 mM R,R-IDS (•) plus 5.3 mM R,S-IDS ({square}) as the sole source of carbon, nitrogen, and energy. The culture was inoculated with a 1% (vol/vol) preculture grown on technical IDS and incubated on a rotary shaker (125 rpm) at 23°C. Shown are optical density ({circ}) and pH ({triangleup}).

Turnover experiments with whole cells of A. tumefaciens BY6 incubated with a mixture of R,S-IDS and R,R-IDS showed that the rate of R,R-IDS consumption depended on the R,S-IDS concentration present (Fig. 5). If R,S-IDS was added during the maximum rate of R,R-IDS turnover (340 min), R,R-IDS turnover stopped immediately and started again after the R,S-IDS concentration decreased to less than 1 mM. The same results were observed with S,S-IDS instead of R,R-IDS (data not shown). The growth and turnover experiments indicate that R,S-IDS is preferred over R,R-IDS and S,S-IDS as a substrate of A. tumefaciens BY6.



View larger version (14K):
[in this window]
[in a new window]
 
FIG. 5. Competitive consumption of R,S-IDS and R,R-IDS by whole cells of A. tumefaciens BY6. Whole cells were obtained by growth in mineral salts medium with technical IDS (5 mM). The cells were harvested, resuspended in phosphate buffer (optical density at 546 nm of 3.5), and incubated at 23°C with 7.5 mM R,S-IDS plus 7.15 mM R,R-IDS on a rotary shaker at 125 rpm. When the maximum rate of R,R-IDS degradation was observed, the cell suspension was split into two samples with the same volume. One sample was incubated further (dashed line). The other sample was amended with R,S-IDS.

C-N lyase from A. tumefaciens BY6 that cleaves R,S-IDS.
The enzyme was purified in order to analyze the initial transformation of IDS. From the whole-cell experiments, it was assumed that IDS degradation was based on a single enzyme with stereoselective preference for R,S-IDS. During the protein purification assays, it turned out that initial S,S-IDS and R,R-IDS degradation required two distinct enzymes, whereas for R,S-IDS the lyase activity was necessary. In the first step, an R,S-IDS-degrading enzyme was purified. The purification procedure is summarized in Table 1. The overall yield during purification was 30.5% and resulted in a 14.1-fold increase in specific activity. The purified enzyme did not require any cofactors and transformed R,S-IDS to fumaric acid and D-aspartic acid. L-Aspartic acid was not detected. These metabolites indicated that the purified R,S-IDS-degrading enzyme is a C-N lyase. It catalyzes a nonhydrolytic cleavage of the C-N bond, generating succinate plus aspartate.


View this table:
[in this window]
[in a new window]
 
TABLE 1. Purification of the R,S-IDS-cleaving C-N lyase from A. tumefaciens BY6

The C-N lyase also catalyzed the reverse reaction. The equilibrium constant Keq was 90 x 10–3 for R,S-IDS (data not shown). The equilibrium constant was determined according to the equation Keq = c(fumaric acid)2/c(R,S-IDS), where c is concentration. Hence, the equilibrium for the reaction is clearly in favor of R,S-IDS cleavage.

Surprisingly, the C-N lyase showed no activity against the R,R-IDS isomer. Only minor activity with S,S-IDS was observed (Table 2), generating L-aspartic acid and fumaric acid as products.


View this table:
[in this window]
[in a new window]
 
TABLE 2. Activity of the C-N lyase with various substratesa

Epimerase from A. tumefaciens BY6.
Further investigations were performed to find an R,R-IDS-degrading enzyme activity. Obviously, the key enzyme for R,R-IDS degradation is an epimerase. It was purified by applying several chromatographic steps, as reported in Table 3. The enzyme was purified 12.7-fold, with a yield of 22.1%.


View this table:
[in this window]
[in a new window]
 
TABLE 3. Purification of the IDS-epimerase from A. tumefaciens BY6

The purified IDS-epimerase did not require any cofactors to transform R,S-IDS into S,S-IDS and R,R-IDS and vice versa. The percentage of each IDS isomer in equilibrium at pH 8.5 was 55.5% R,S-IDS, 27.8% S,S-IDS, and 16.7% R,R-IDS.

Cell extracts of A. tumefaciens BY6 cells grown with nutrient broth medium as the sole source of carbon, nitrogen, and energy exhibited no IDS-epimerase or C-N lyase activity at all, indicating the inducibility of these enzymes.

Characterization of the C-N lyase.
The purified C-N lyase gave a single band by SDS-PAGE and had a molecular mass of approximately 57 kDa. By analytical gel filtration, the molecular mass of the native enzyme was determined to be 260 kDa. Therefore, it can be assumed that the C-N lyase is a homotetramer. N-terminal amino acid sequencing by automated Edman degradation revealed the sequence MRERLSASPNELIVKHLIGPRLFGNLDRDFLEM(X/S)KVN. A BLAST (1) search showed no significant similarity to any known protein sequences. The purified enzyme exhibited a typical protein absorption spectrum with a maximum at 280 nm. The pH optimum for lyase activity was found to be pH 8.0 to 8.5. No activity was left at pH 5.5 (Na+-phosphate buffer) and pH 9.5 (Na+-carbonate and Tris buffer). The enzyme showed maximum activity between 35 and 40°C, whereas no activity was observed at 60°C. The isoelectric point was found to be 5.95. The kinetic data for R,S-IDS at pH 8.5 were Km, 1.0 ± 0.2 mM; Vmax, 170 µmol/min; kcat, 228 s–1; and kcat/Km, 2.3 x 106.

The C-N lyase activity with S,S-IDS as the substrate was only 2.5% of the activity with R,S-IDS (Table 2). Therefore, the enzyme kinetic parameters for S,S-IDS were not determined.

Some metal-R,S-IDS complexes were transformed by the C-N lyase: Ca2+-R,S-IDS was transformed with the highest specific activity, followed by Mg2+-R,S-IDS and Mn2+-R,S-IDS, whereas Fe2+-, Fe3+-, Zn2+-, and Cu2+-R,S-IDS were not transformed at all.

Other substrates such as aspartic acid racemate, the aminopolycarboxylate ethylenediaminedisuccinate (EDDS), and the opine N,N-(1,3-dicarboxypropyl)-L-arginine (nopaline) were not transformed by the C-N lyase (Table 2).

Characterization of the IDS-epimerase.
The molecular mass of native IDS-epimerase calculated by gel filtration was 170 kDa. The SDS-PAGE analysis gave a single protein band corresponding to a molecular mass of 48 kDa. The purified enzyme showed a typical protein absorption spectrum with a maximum at 280 nm. The N-terminal amino acid sequence of IDS-epimerase was determined to be MFTTKLAEKVVSAWKAKISQPALKAAQD. By protein sequence alignment with BLAST, no significant similarity to any known protein sequences was found.

The optimal pH for IDS-epimerase activity was 8.5, with a remaining activity of 87, 44, and 8% at pH 8.0, 7.5, and 9.0, respectively. The temperature optimum was 35°C, whereas no significant activity was observed at temperatures above 50°C. The pI was 6.3. The kinetic parameters are presented in Table 4.


View this table:
[in this window]
[in a new window]
 
TABLE 4. Kinetic parameters of the IDS-epimerasea

Comparing the IDS isomers, S,S-IDS was transformed with the highest specific activity, twice as high as that of R,R-IDS and 10 times faster than that of R,S-IDS. Only the alkaline earth metal Ca2+-, Ba2+-, and Mg2+-R,R-IDS complexes showed moderate activity, with 52, 44, and 25% of the activity with S,S-IDS, respectively. The epimerase transformed Ca2+-R,R-IDS and R,R-IDS with similar activities. The other metal-IDS complexes were transformed at very slow rates or not at all (Table 5). EDDS isomers were not epimerized by the enzyme.


View this table:
[in this window]
[in a new window]
 
TABLE 5. Activity of the IDS-epimerase with IDS, different metal-IDS complexes, EDDS, and aspartic acid


arrow
DISCUSSION
 
The IDS isomers of the technical mixture are readily biodegradable, according to OECD guideline 301F. Even some metal-IDS complexes fulfill the criteria of ready biodegradability, such as Ca2+- and Fe2+-IDS. In contrast, Mn2+- and Cu2+-IDS revealed only 55 and 40% biodegradation after 28 days, respectively. Interestingly, the Mn2+- and Cu2+-IDS degradation rates were initially similar to these of Ca2+- and Fe2+-IDS (Fig. 2). We assume that prolonged exposure to the released Cu2+ and Mn2+ ions led to inactivation of the microorganisms.

A correlation between complex formation constants (pK) and degradation rates was not observed. The pK values of Ca2+-, Mn2+-, Fe2+-, and Cu2+-IDS were 6.7, 7.3, 8.2, and 14.3, respectively (3). We presume that metal-IDS complexes were not transported into the cells, since heavy metal precipitation was observed in the medium during growth and biodegradation tests. Interestingly, the C-N lyase from A. tumefaciens BY6 showed no activity against Fe2+-R,S-IDS, although strain BY6 degraded Fe2+-R,S-IDS. This supports the assumption that metal-IDS complexes were not taken up by the cells. Witschel et al. (26) reported EDTA uptake by strain DSM 9103. Only free EDTA and complexes with a low complex formation constant, such as the alkaline earth metal chelates, were taken up, whereas heavy metal EDTA complexes remained outside the cells.

The initial transformations of the three IDS isomers by A. tumefaciens BY6 are summarized in Fig. 6. A. tumefaciens BY6 caused a pH increase during growth on IDS. The metabolite ammonia was detected and should be a deamination product of aspartic acid, probably cleaved by an L-aspartate ammonia-lyase. D-Aspartate ammonia-lyases are still unknown, and therefore D-aspartic acid as a product of R,S-IDS degradation must be transformed into L-aspartic acid, probably by an aspartate racemase, as described by Rahmanian et al. (19).



View larger version (18K):
[in this window]
[in a new window]
 
FIG. 6. Initial transformation of IDS isomers by A. tumefaciens BY6 involving an IDS-isomerase and a C-N lyase. Further metabolism by an aspartate racemase and an L-aspartase is assumed from the known metabolism of aspartate. The dashed arrow documents side activity of the C-N lyase.

The isolated R,S-IDS-degrading enzyme, classified as a C-N lyase (EC 4.3.3), had a clear preference for R,S-IDS and only minor activity for S,S-IDS (Table 2). The C-N lyase cleaved only the S configuration of IDS and required the R configuration at the other asymmetric carbon atom of IDS.

A similar IDS-cleaving C-N lyase from Ralstonia sp. strain SLRS7 has been described previously (7). This enzyme also cleaves only the S configuration of IDS but has equal specific activity towards S,S-IDS and R,S-IDS. The C-N lyases from Ralstonia sp. strain SLSR7 and A. tumefaciens BY6 resemble each other in molecular mass, subunit organization, pH and temperature optima, Km, equilibrium constant Keq, and activity towards different metal-IDS complexes. The R,R-IDS isomer was not cleaved by either C-N lyase. Remarkably the S,S isomer of EDDS, another important substitute of EDTA, was only transformed by the Ralstonia sp. strain SLRS7 C-N lyase. Since the R,R-IDS isomer can be degraded and used by A. tumefaciens BY6, an additional activity, an IDS-epimerase, is necessary. This activity transforms R,R-IDS and S,S-IDS into the C-N lyase substrate R,S-IDS.

Many epimerases, especially racemases, require pyridoxal 5'-phosphate (PLP) as a cofactor when racemization proceeds through the formation of aldimine Schiff base between the substrate amino acid and PLP (22). Since the spectrum of the purified IDS-epimerase shows no significant absorption in the range of 350 to 450 nm, there is no indication of PLP as a cofactor. Many other amino acid epimerases or racemases such as diaminopimelic acid epimerase (23), 4-hydroxyproline epimerase (9), proline racemase (6, 21), aspartate racemase (27), and glutamate racemase (13) also require no cofactor. We assume that enzyme-catalyzed epimerization of IDS is accomplished by a proton abstraction and subsequent return by a two-base mechanism, as proposed for PLP-independent epimerases and racemases (21, 23, 27). In a two-base mechanism, one enzyme base removes the proton from the substrate, and the conjugate base delivers a proton in the opposite direction (6).

The observed mechanism for the complete mineralization of all IDS isomers involving an epimerase offers an interesting possibility of circumventing an initial stereoselective catabolic step, as described for C-N lyases involved in IDS and EDDS degradation (7, 25).


arrow
ACKNOWLEDGMENTS
 
We thank Bayer AG, Leverkusen, Germany, for partially funding this work and Torsten Groth (Bayer) for supplying us with technical IDS and the pure isomers.

Thanks are also due to H. Weber (Prosequenz Bioanalytik, Kornwestheim, Germany) for N-terminal amino acid sequencing.


arrow
FOOTNOTES
 
* Corresponding author. Mailing address: Institut für Mikrobiologie, Universität Stuttgart, 70569 Stuttgart, Germany. Phone: 49-711-6855480. Fax: 49-711-6855725. E-mail: pg.rieger{at}po.uni-stuttgart.de. Back


arrow
REFERENCES
 
    1
  1. Altschul, S. F., T. L. Madden, A. A. Schäffer, J. Zhang, Z. Zhang, W. Miller, and D. J. Lipman. 1997. Gapped BLAST and PSI_BLAST; a new generation of protein database search programs. Nucleic Acids Res. 25:3389-3402.[Abstract/Free Full Text]
  2. 2
  3. Bayer AG. 2001. Safety data sheet 857037/10, Baypure CX 100 solid. Bayer AG, Leverkusen, Germany.
  4. 3
  5. Bayer AG. 1998. IDS Na-Salz. Eine neue umweltfreundliche Alternative zu klassischen Komplexierungsmitteln. Bayer AG, Leverkusen, Germany.
  6. 4
  7. Bradford, M. M. 1976. A rapid and sensitive method for the quantification of microgram quantities of proteins utilizing the principle of protein-dye binding. Anal. Biochem. 72:248-254.[CrossRef][Medline]
  8. 5
  9. Bucheli-Witschel, M., and T. Egli. 2001. Environmental fate and microbial degradation of aminopolycarboxylic acids. FEMS Microbiol. Rev. 25:69-106.[CrossRef][Medline]
  10. 6
  11. Cardinale, G. J., and R. H. Abeles. 1968. Purification and mechanism of action of proline racemase. Biochemistry 7:3970-3978.[CrossRef][Medline]
  12. 7
  13. Cokesa, ., S. Lakner, H.-J. Knackmuss, and P.-G. Rieger. A stereoselective carbon-nitrogen lyase from Ralstonia sp. SLRS7 cleaves two of three isomers of iminodisuccinate. Biodegradation, in press.
  14. 8
  15. Einarsson, S., and B. Josefsson. 1987. Separation of amino acid enantiomers and chiral amines using precolumn derivatization with (+)-1-(9-fluorenyl)ethylchloroformate and reversed-phase liquid chromatography. Anal. Chem. 59:1191-1195.[Medline]
  16. 9
  17. Finlay, T. H., and E. Adams. 1970. Kinetic and structural studies of hydroxyproline 2-epimerase. J. Biol. Chem. 245:5248-5260.[Abstract/Free Full Text]
  18. 10
  19. Kari, F. G., S. U. Hilger, and S. Cannonica. 1995. Determination of the reaction quantum yield for the photochemical degradation of Fe(III)-EDTA—implications for the environmental fate of EDTA in surface waters. Environ. Sci. Technol. 29:1008-1017.
  20. 11
  21. Laemmli, U. K. 1970. Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature 227:680-685.[CrossRef][Medline]
  22. 12
  23. Lauff, J. J., D. B. Steele, L. A. Coogan, and J. M. Breitfeller. 1990. Degradation of the ferric chelate of EDTA by a pure culture of an Agrobacterium sp. Appl. Environ. Microbiol. 56:3346-3353.[Abstract/Free Full Text]
  24. 13
  25. Nakajima, N., K. Tanizawa; H. Tanaka, and K. Soda. 1986. Cloning and expression in Escherichia coli of the glutamate racemase gene from Pediococcus pentosaceus. Agric. Biol. Chem. 50:2823-2830.
  26. 14
  27. Nörtemann, B. 1992. Total degradation of EDTA by mixed cultures and a bacterial isolate. Appl. Environ. Microbiol. 58:671-676.[Abstract/Free Full Text]
  28. 15
  29. Nowack, B., H. Xue, and L. Sigg. 1997. Influence of natural and anthropogenic ligands on metal transport during infiltration of river water to groundwater. Environ. Sci. Technol. 31:866-872.[CrossRef]
  30. 16
  31. Nowack, B., F. G. Kari, and H. G Krüger. 2001. The remobilization of metals from iron oxides and sediments by metal-EDTA complexes. Water Air Soil Pollut. 125:243-257.[CrossRef]
  32. 17
  33. Organization for Economic Cooperation and Development. 1993. Guidelines for testing of chemicals. The OECD Expert Group on Degradation and Accumulation. Ready Biodegradability 301 F: manometric respirometry test. Organization for Economic Cooperation and Development, Paris, France.
  34. 18
  35. Pfennig, N., and K. D. Lippert. 1966. Über das Vitamin B12-Bedürfnis phototropher Schwefelbakterien. Arch. Mikrobiol. 55:245-256.[CrossRef]
  36. 19
  37. Rahmanian, M., Waller, G. R., and W. G. Smith. 1971. Biosynthesis of D-aspartic acid by Streptococcus faecalis. J. Biol. Chem. 246:823-830.[Abstract/Free Full Text]
  38. 20
  39. Reinecke, F., T. Groth, K.-P. Heise, W. Joentgen, N. Müller, and A. Steinbüchel. 2000. Isolation and characterization of an Achromobacter xylosoxidans strain B3 and other bacteria capable to degrade the synthetic chelating agent iminodisuccinate. FEMS Microbiol. Lett. 188:41-46.[CrossRef][Medline]
  40. 21
  41. Rudnick, G., and R. H. Abeles. 1975. Reaction mechanism and structure of the active site of proline racemase. Biochemistry 14:4515-4522.[CrossRef][Medline]
  42. 22
  43. Snell, E. E., and S. J. Di Mari. 1970. Kinetics and mechanism, p. 353-370. In P. D. Boyer, H. Lardy, and K. Myrbäck (ed.), The enzymes, vol. 2. Academic Press, New York, N.Y.
  44. 23
  45. Wieseman, J. S., and J. S. Nichols. 1984. Purification and properties of diaminopimelic acid epimerase from Escherichia coli. J. Biol. Chem. 259:8907-8914.[Abstract/Free Full Text]
  46. 24
  47. Witschel, M., S. Nagel, and T. Egli. 1997. Identification of the two-enzyme system catalyzing oxidation of EDTA in the EDTA-degrading bacterial strain DSM 9103. J. Bacteriol. 179:6937-6943.[Abstract/Free Full Text]
  48. 25
  49. Witschel, M., and T. Egli. 1998. Purification and characterization of a lyase from the EDTA-degrading bacterial strain DSM 9103 that catalyzes the splitting of [S,S]-ethylenediaminedisuccinate, a structural isomer of EDTA. Biodegradation 8:419-428.[CrossRef]
  50. 26
  51. Witschel, M., T. Egli, A. J. B. Zehnder, E. Wehrli, and M. Spycher. 1999. Transport of EDTA into cells of the EDTA-degrading bacterial strain DSM 9103. Microbiology 145:973-983.
  52. 27
  53. Yamauchi, T., S.-Y. Choi, H. Okada, M. Yohda, H. Kumagai, N. Esaki, and K. Soda. 1992. Properties of aspartate racemase, a pyridoxal 5'-phosphate-independent amino acid racemase. J. Biol. Chem. 267:18361-18364.[Abstract/Free Full Text]


Applied and Environmental Microbiology, July 2004, p. 3941-3947, Vol. 70, No. 7
0099-2240/04/$08.00+0     DOI: 10.1128/AEM.70.7.3941-3947.2004
Copyright © 2004, American Society for Microbiology. All Rights Reserved.




This article has been cited by other articles:

  • Bauerle, B., Cokesa, Z., Hofmann, S., Rieger, P.-G. (2006). Sequencing and Heterologous Expression of an Epimerase and Two Lyases from Iminodisuccinate-Degrading Bacteria. Appl. Environ. Microbiol. 72: 2824-2828 [Abstract] [Full Text]  

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Cokesa, Z.
Right arrow Articles by Rieger, P.-G.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Cokesa, Z.
Right arrow Articles by Rieger, P.-G.
Agricola
Right arrow Articles by Cokesa, Z.
Right arrow Articles by Rieger, P.-G.