AEM
Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]
Author's Correction for Hathout et al., Appl. Environ. Microbiol. 69 (2) 1100-1107.
This Article
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Hathout, Y.
Right arrow Articles by Setlow, P.
Right arrow Search for Related Content
PubMed
Right arrow Articles by Hathout, Y.
Right arrow Articles by Setlow, P.
Agricola
Right arrow Articles by Hathout, Y.
Right arrow Articles by Setlow, P.

 Previous Article

Applied and Environmental Microbiology, September 2005, p. 5663, Vol. 71, No. 9
0099-2240/05/$08.00+0     doi:10.1128/AEM.71.9.5663.2005

AUTHOR'S CORRECTION

Small, Acid-Soluble Proteins as Biomarkers in Mass Spectrometry Analysis of Bacillus Spores

Yetrib Hathout, Barbara Setlow, Rosa-Martha Cabrera-Martinez, Catherine Fenselau, and Peter Setlow

Department of Chemistry and Biochemistry, University of Maryland, College Park, Maryland 20704, and Department of Biochemistry, University of Connecticut Health Center, Farmington, Connecticut 06032

Volume 69, no. 2, p. 1100-1107, 2003. Page 1103, Table 1: "SASP-1" should be replaced by "SASPBg", and the corresponding sequence should read as follows: AQNSQNGNSSNQLLVPGAAQAIDQMKFEIASEFGVNLGAETTSRANGSVGGEITKRLVSFAQQNMSGQQF.

Applied and Environmental Microbiology, September 2005, p. 5663, Vol. 71, No. 9
0099-2240/05/$08.00+0     doi:10.1128/AEM.71.9.5663.2005





This Article
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Hathout, Y.
Right arrow Articles by Setlow, P.
Right arrow Search for Related Content
PubMed
Right arrow Articles by Hathout, Y.
Right arrow Articles by Setlow, P.
Agricola
Right arrow Articles by Hathout, Y.
Right arrow Articles by Setlow, P.

Home Help [Feedback] [For Subscribers] [Archive] [Search] [Contents]
J. Bacteriol. Microbiol. Mol. Biol. Rev. Eukaryot. Cell All ASM Journals